PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C002618P2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 168aa    MW: 18487 Da    PI: 5.6597
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C002618P2genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.57.1e-4283159278
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     Cq+++C+adls  k+yhrrhkvCe+h+kap+v+v+g+ qrfCqqCsrfh l+efD++krsCr+rLa+hn+rrrk+++
  MELO3C002618P2  83 CQADNCNADLSGSKRYHRRHKVCEFHAKAPAVAVAGIDQRFCQQCSRFHGLQEFDDTKRSCRKRLAGHNQRRRKSSS 159
                     **************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.9E-3578144IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.66780157IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.15E-3981161IPR004333Transcription factor, SBP-box
PfamPF031102.3E-3283156IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MATGKADGKR RLNYYEMEEE DEEDEEEEEE EDEDEEQEID GGGLGFSGDF NKKKKVLTSG  60
GSSNKKSGSG FGTGPPAAAP PPCQADNCNA DLSGSKRYHR RHKVCEFHAK APAVAVAGID  120
QRFCQQCSRF HGLQEFDDTK RSCRKRLAGH NQRRRKSSSD LHGESST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-35831561184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151156QRRRKS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008442764.11e-121PREDICTED: squamosa promoter-binding-like protein 3 isoform X1
TrEMBLA0A0A0LSD92e-78A0A0A0LSD9_CUCSA; Squamosa promoter-binding-like protein
STRINGVIT_10s0003g00050.t015e-45(Vitis vinifera)
STRINGPOPTR_0001s40870.12e-44(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.19e-40squamosa promoter binding protein-like 3